PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000299959
Common NameNAC18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 363aa    MW: 41915.1 Da    PI: 4.8344
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000299959genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-5591381129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     ++e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v+
  MDP0000299959   9 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQErcrIGYEEQNEWYFFSHKDKKYPTGTRTNRATMAGFWKATGRDKSVY 103
                    69****************************.9***************953432233667************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                    + k +l+g++ktLvfykgrap+g+ktdW+mheyrle
  MDP0000299959 104 D-KAKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 138
                    *.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.03E-587176IPR003441NAC domain
PROSITE profilePS5100558.1449176IPR003441NAC domain
PfamPF023654.8E-2910137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MMESIECTVP PGFRFHPTDE ELVGYYLRKK VASQKIDLDV IRDIDLYRIE PWDLQERCRI  60
GYEEQNEWYF FSHKDKKYPT GTRTNRATMA GFWKATGRDK SVYDKAKLIG MRKTLVFYKG  120
RAPNGQKTDW IMHEYRLESD ENGPPQAKRK LQKLIKENAC ICIKEEGWVV CRAFKKRISS  180
QNKSIEGWDS SYFYEELNGL TSVADPTDFM ISRQPQSFLS QNFMCKQETE ADSLNFLHSD  240
PFVQLPQLES PSLPLIKRPT SMSLISENNT ELEDEQSIRG CNNAEKVTDW RALDKFVASQ  300
LSQEERYEGD GEASFGAHDE SDMSLLLLQS SSARDDDDQV ENKLNGFLNS SPDCDIGICI  360
FEK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-51617712169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008372770.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_008372771.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9SL411e-157NAC37_ARATH; NAC domain-containing protein 37
TrEMBLD9ZJ950.0D9ZJ95_MALDO; NAC domain class transcription factor
STRINGVIT_04s0023g03110.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45653459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18060.11e-144vascular related NAC-domain protein 1